1ZTR
Solution structure of engrailed homeodomain l16a mutant
PDB DOI: 10.2210/pdb1ztr/pdb
Classification: TRANSCRIPTION Organism(s): Drosophila Melanogaster
Deposited: 2005-05-27 Deposition Author(s): Fersht, A.R. , Freund, S.M.V. , Markson, J.S. , Mayor, U. , Religa, T.L.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of engrailed homeodomain l16a mutant
Fersht, A.R. , Freund, S.M.V. , Markson, J.S. , Mayor, U. , Religa, T.L.
Primary Citation of Related Structures: 1ZTR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Segmentation polarity homeobox protein engrailed | A | 61 | Drosophila Melanogaster | GDEKRPRTAFSSEQLARAKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIRRS |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-05-27 Deposition Author(s): Fersht, A.R. , Freund, S.M.V. , Markson, J.S. , Mayor, U. , Religa, T.L.