Inactivation gate of potassium channel raw3, nmr, 8 structures
PDB DOI: 10.2210/pdb1ztn/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 1996-11-15 Deposition Author(s): Antz, C. , Fakler, B. , Frank, R. , Geyer, M. , Guy, H.R. , Kalbitzer, H.R. , Ruppersberg, J.P. , Schott, M.
Method: SOLUTION NMR Resolution: N.A.
Inactivation gate of potassium channel raw3, nmr, 8 structures
Antz, C. , Fakler, B. , Frank, R. , Geyer, M. , Guy, H.R. , Kalbitzer, H.R. , Ruppersberg, J.P. , Schott, M.
Primary Citation of Related Structures: 1ZTN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium voltage-gated channel subfamily C member 4 | A | 30 | Homo Sapiens | MISSVCVSSYRGRKSGNKPPSKTCLKEEMA |
Method: SOLUTION NMR
Deposited Date: 1996-11-15 Deposition Author(s): Antz, C. , Fakler, B. , Frank, R. , Geyer, M. , Guy, H.R. , Kalbitzer, H.R. , Ruppersberg, J.P. , Schott, M.