Solution structure of the sap domain of human e1b-55kda-associated protein 5 isoform c
PDB DOI: 10.2210/pdb1zrj/pdb
Classification: DNA BINDING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2005-05-19 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.
Solution structure of the sap domain of human e1b-55kda-associated protein 5 isoform c
Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1ZRJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E1B-55kDa-associated protein 5 isoform c | A | 50 | Salmonella Enterica | GSSGSSGMDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-19 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.