Crystal structure of protein kinase ck2 in complex with tbb-derivatives inhibitors
PDB DOI: 10.2210/pdb1zoe/pdb
Classification: TRANSFERASE Organism(s): Zea Mays
Deposited: 2005-05-13 Deposition Author(s): Battistutta, R. , Kazimierczuk, Z. , Mazzorana, M. , Pinna, L.A. , Sarno, S. , Zanotti, G.
Crystal structure of protein kinase ck2 in complex with tbb-derivatives inhibitors
Battistutta, R. , Kazimierczuk, Z. , Mazzorana, M. , Pinna, L.A. , Sarno, S. , Zanotti, G.
Primary Citation of Related Structures: 1ZOE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein kinase CK2, alpha Subunit | A | 332 | Zea Mays | MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-05-13 Deposition Author(s): Battistutta, R. , Kazimierczuk, Z. , Mazzorana, M. , Pinna, L.A. , Sarno, S. , Zanotti, G.