Nmr structure of antizyme isoform 1 from rat
PDB DOI: 10.2210/pdb1zo0/pdb
Classification: LYASE INHIBITOR Organism(s): Rattus Norvegicus
Deposited: 2005-05-12 Deposition Author(s): Hackert, M.L. , Hoffman, D.W.
Nmr structure of antizyme isoform 1 from rat
Primary Citation of Related Structures: 1ZO0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ornithine decarboxylase antizyme | A | 126 | Rattus Norvegicus | ILYSDERLNVTEEPTSNDKTRVLSIQCTLTEAKQVTWRAVWNGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLRADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLE |
Method: SOLUTION NMR
Deposited Date: 2005-05-12 Deposition Author(s): Hackert, M.L. , Hoffman, D.W.