Strong solute-solute dispersive interactions in a protein-ligand complex
PDB DOI: 10.2210/pdb1znh/pdb
Classification: TRANSPORT PROTEIN Organism(s): Mus Musculus
Deposited: 2005-05-11 Deposition Author(s): Barratt, E. , Bingham, R.J. , Homans, S.W. , Johnstone, S. , Laughton, C.A. , Malham, R. , Phillips, S.E.
Strong solute-solute dispersive interactions in a protein-ligand complex
Barratt, E. , Bingham, R.J. , Homans, S.W. , Johnstone, S. , Laughton, C.A. , Malham, R. , Phillips, S.E.
Primary Citation of Related Structures: 1ZNH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Major Urinary Protein | A | 174 | Mus Musculus | MRGSHHHHHHGSEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-05-11 Deposition Author(s): Barratt, E. , Bingham, R.J. , Homans, S.W. , Johnstone, S. , Laughton, C.A. , Malham, R. , Phillips, S.E.