Solution structure of the n-terminal domain (m1-s98) of human centrin 2
PDB DOI: 10.2210/pdb1zmz/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-05-11 Deposition Author(s): Assairi, L. , Blouquit, Y. , Craescu, C.T. , Duchambon, P. , Miron, S. , Yang, A.
Solution structure of the n-terminal domain (m1-s98) of human centrin 2
Assairi, L. , Blouquit, Y. , Craescu, C.T. , Duchambon, P. , Miron, S. , Yang, A.
Primary Citation of Related Structures: 1ZMZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Centrin-2 | A | 98 | Homo Sapiens | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMS |
Method: SOLUTION NMR
Deposited Date: 2005-05-11 Deposition Author(s): Assairi, L. , Blouquit, Y. , Craescu, C.T. , Duchambon, P. , Miron, S. , Yang, A.