Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
PDB DOI: 10.2210/pdb1zl8/pdb
Classification: PROTEIN BINDING Organism(s): Human Herpesvirus 6B (Strain Hst) , Salmonella Enterica
Deposited: 2005-05-05 Deposition Author(s): Dotsch, V. , Lim, W.A. , Lohr, F. , Ou, H.D. , Petrosky, K.Y.
Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Dotsch, V. , Lim, W.A. , Lohr, F. , Ou, H.D. , Petrosky, K.Y.
Primary Citation of Related Structures: 1ZL8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
LIN-7 | A | 53 | Human Herpesvirus 6B (Strain Hst) , Salmonella Enterica | GSLNLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVY |
Peripheral plasma membrane protein CASK | B | 54 | Human Herpesvirus 6B (Strain Hst) , Salmonella Enterica | SDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEA |
Method: SOLUTION NMR
Deposited Date: 2005-05-05 Deposition Author(s): Dotsch, V. , Lim, W.A. , Lohr, F. , Ou, H.D. , Petrosky, K.Y.