Crystal structure of ribonuclease mutant
PDB DOI: 10.2210/pdb1zgx/pdb
Classification: HYDROLASE Organism(s): Streptomyces Aureofaciens
Deposited: 2005-04-22 Deposition Author(s): Sevcik, J. , Urbanikova, L.
Method: X-RAY DIFFRACTION Resolution: 1.13 Å
Crystal structure of ribonuclease mutant
Primary Citation of Related Structures: 1ZGX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Guanyl-specific ribonuclease Sa | A | 63 | Streptomyces Aureofaciens | DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGAR |
| Guanyl-specific ribonuclease Sa | B | 33 | Streptomyces Aureofaciens | TRGTRRIITGEATQEDYYTGDHYATFSLIDKTC |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-04-22 Deposition Author(s): Sevcik, J. , Urbanikova, L.