Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase
PDB DOI: 10.2210/pdb1zco/pdb
Classification: LYASE Organism(s): Pyrococcus Furiosus
Deposited: 2005-04-12 Deposition Author(s): Anderson, B.F. , Jameson, G.B. , Norris, G.E. , Parker, E.J. , Patchett, M.L. , Schofield, L.R.
Crystal structure of pyrococcus furiosus 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase
Anderson, B.F. , Jameson, G.B. , Norris, G.E. , Parker, E.J. , Patchett, M.L. , Schofield, L.R.
Primary Citation of Related Structures: 1ZCO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 2-dehydro-3-deoxyphosphoheptonate aldolase | A | 262 | Pyrococcus Furiosus | MKYSKEYDEKTVVKINDVKFGEGFTIIAGPCSIESREQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG |
| 2-dehydro-3-deoxyphosphoheptonate aldolase | B | 262 | Pyrococcus Furiosus | MKYSKEYDEKTVVKINDVKFGEGFTIIAGPCSIESREQIMKVAEFLAEVGIKVLRGGAFKPRTSPYSFQGYGEKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEVGKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFETATRFTLDISAVPVVKELSHLPIIVDPSHPAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSDSQQQLTFDDFLQLLKELEALGWKG |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-04-12 Deposition Author(s): Anderson, B.F. , Jameson, G.B. , Norris, G.E. , Parker, E.J. , Patchett, M.L. , Schofield, L.R.