Nmr solution structure of a leaf-specific-expressed cyclotide vhl-1
PDB DOI: 10.2210/pdb1za8/pdb
Classification: ANTIVIRAL PROTEIN Organism(s): Viola Hederacea
Deposited: 2005-04-05 Deposition Author(s): Chen, B. , Colgrave, M.L. , Craik, D.J. , Daly, N.L. , Gustafson, K.R. , Rosengren, K.J.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of a leaf-specific-expressed cyclotide vhl-1
Chen, B. , Colgrave, M.L. , Craik, D.J. , Daly, N.L. , Gustafson, K.R. , Rosengren, K.J.
Primary Citation of Related Structures: 1ZA8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| vhl-1 | A | 31 | Viola Hederacea | CGESCAMISFCFTEVIGCSCKNKVCYLNSIS |
Method: SOLUTION NMR
Deposited Date: 2005-04-05 Deposition Author(s): Chen, B. , Colgrave, M.L. , Craik, D.J. , Daly, N.L. , Gustafson, K.R. , Rosengren, K.J.