A structural model for the membrane-bound form of the juxtamembrane domain of the epidermal growth factor receptor
PDB DOI: 10.2210/pdb1z9i/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2005-04-02 Deposition Author(s): Carlin, C.R. , Choowongkomon, K. , Sonnichsen, F.D.
A structural model for the membrane-bound form of the juxtamembrane domain of the epidermal growth factor receptor
Carlin, C.R. , Choowongkomon, K. , Sonnichsen, F.D.
Primary Citation of Related Structures: 1Z9I
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Epidermal growth factor receptor | A | 53 | Salmonella Enterica | RRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGSG |
Method: SOLUTION NMR
Deposited Date: 2005-04-02 Deposition Author(s): Carlin, C.R. , Choowongkomon, K. , Sonnichsen, F.D.