Crystal structure of the mud1 uba domain
PDB DOI: 10.2210/pdb1z96/pdb
Classification: PROTEIN TRANSPORT Organism(s): Conus Stercusmuscarum
Deposited: 2005-03-31 Deposition Author(s): Brown, N.R. , Campbell, I.D. , Endicott, J.A. , Gordon, C. , Johnson, L.N. , Lowe, E.D. , Noble, M.E.M. , Trempe, J.-F.
Crystal structure of the mud1 uba domain
Brown, N.R. , Campbell, I.D. , Endicott, J.A. , Gordon, C. , Johnson, L.N. , Lowe, E.D. , Noble, M.E.M. , Trempe, J.-F.
Primary Citation of Related Structures: 1Z96
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
UBA-domain protein mud1 | A | 40 | Conus Stercusmuscarum | DPGLNSKIAQLVSMGFDPLEAAQALDAANGDLDVAASFLL |
UBA-domain protein mud1 | B | 40 | Conus Stercusmuscarum | DPGLNSKIAQLVSMGFDPLEAAQALDAANGDLDVAASFLL |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-03-31 Deposition Author(s): Brown, N.R. , Campbell, I.D. , Endicott, J.A. , Gordon, C. , Johnson, L.N. , Lowe, E.D. , Noble, M.E.M. , Trempe, J.-F.