Solution structure of the pdz domain of alpha-syntrophin
PDB DOI: 10.2210/pdb1z86/pdb
Classification: PROTEIN BINDING Organism(s): Mus Musculus
Deposited: 2005-03-30 Deposition Author(s): Adams, M.E. , Froehner, S.C. , Long, J.F. , Wen, W. , Xu, W. , Yan, J. , Zhang, M.
Solution structure of the pdz domain of alpha-syntrophin
Adams, M.E. , Froehner, S.C. , Long, J.F. , Wen, W. , Xu, W. , Yan, J. , Zhang, M.
Primary Citation of Related Structures: 1Z86
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alpha-1-syntrophin | A | 87 | Mus Musculus | RRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKE |
Method: SOLUTION NMR
Deposited Date: 2005-03-30 Deposition Author(s): Adams, M.E. , Froehner, S.C. , Long, J.F. , Wen, W. , Xu, W. , Yan, J. , Zhang, M.