Solution structure of the carboxy-terminal domain of human tfiih p44 subunit
PDB DOI: 10.2210/pdb1z60/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2005-03-21 Deposition Author(s): Boelens, R. , Dominguez, C. , Fribourg, S. , Kellenberger, E. , Kieffer, B. , Moras, D. , Poterszman, A. , Wasielewski, E.
Solution structure of the carboxy-terminal domain of human tfiih p44 subunit
Boelens, R. , Dominguez, C. , Fribourg, S. , Kellenberger, E. , Kieffer, B. , Moras, D. , Poterszman, A. , Wasielewski, E.
Primary Citation of Related Structures: 1Z60
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TFIIH basal transcription factor complex p44 subunit | A | 59 | Homo Sapiens | LDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHSCPGCI |
Method: SOLUTION NMR
Deposited Date: 2005-03-21 Deposition Author(s): Boelens, R. , Dominguez, C. , Fribourg, S. , Kellenberger, E. , Kieffer, B. , Moras, D. , Poterszman, A. , Wasielewski, E.