Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 2'-monophosphate
PDB DOI: 10.2210/pdb1z4j/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2005-03-16 Deposition Author(s): Bianchi, V. , Nordlund, P. , Rinaldo-Matthis, A. , Ruzzenente, B. , Wallden, K.
Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 2'-monophosphate
Bianchi, V. , Nordlund, P. , Rinaldo-Matthis, A. , Ruzzenente, B. , Wallden, K.
Primary Citation of Related Structures: 1Z4J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'(3')-deoxyribonucleotidase | A | 197 | Homo Sapiens | GGRALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-03-16 Deposition Author(s): Bianchi, V. , Nordlund, P. , Rinaldo-Matthis, A. , Ruzzenente, B. , Wallden, K.