X-ray crystal structure of a mutant ribonuclease s (f8anb)
PDB DOI: 10.2210/pdb1z3l/pdb
Classification: HYDROLASE Organism(s): Parengyodontium Album , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-03-14 Deposition Author(s): Das, M. , Ghosh, S. , Varadarajan, R. , Vasudeva Rao, B.
X-ray crystal structure of a mutant ribonuclease s (f8anb)
Das, M. , Ghosh, S. , Varadarajan, R. , Vasudeva Rao, B.
Primary Citation of Related Structures: 1Z3L
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ribonuclease pancreatic, S-Peptide | S | 15 | Parengyodontium Album , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KETAAAKAERQHLDS |
Ribonuclease pancreatic, S-Protein | E | 104 | Parengyodontium Album , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-03-14 Deposition Author(s): Das, M. , Ghosh, S. , Varadarajan, R. , Vasudeva Rao, B.