Solution structure of apo, oxidized yeast cox17
PDB DOI: 10.2210/pdb1z2g/pdb
Classification: CHAPERONE Organism(s): Saccharomyces Cerevisiae
Deposited: 2005-03-08 Deposition Author(s): Arnesano, F. , Balatri, E. , Banci, L. , Bertini, I. , Structural Proteomics In Europe (Spine) , Winge, D.R.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of apo, oxidized yeast cox17
Arnesano, F. , Balatri, E. , Banci, L. , Bertini, I. , Structural Proteomics In Europe (Spine) , Winge, D.R.
Primary Citation of Related Structures: 1Z2G
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cytochrome c oxidase copper chaperone | A | 69 | Saccharomyces Cerevisiae | MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN |
Method: SOLUTION NMR
Deposited Date: 2005-03-08 Deposition Author(s): Arnesano, F. , Balatri, E. , Banci, L. , Bertini, I. , Structural Proteomics In Europe (Spine) , Winge, D.R.