Solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb
PDB DOI: 10.2210/pdb1z0r/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis
Deposited: 2005-03-02 Deposition Author(s): Andreeva, A. , Bobay, B.G. , Cavanagh, J. , Mueller, G.A. , Murzin, A.G.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb
Andreeva, A. , Bobay, B.G. , Cavanagh, J. , Mueller, G.A. , Murzin, A.G.
Primary Citation of Related Structures: 1Z0R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transition state regulatory protein abrB | A | 53 | Bacillus Subtilis | MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT |
| Transition state regulatory protein abrB | B | 53 | Bacillus Subtilis | MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT |
Method: SOLUTION NMR
Deposited Date: 2005-03-02 Deposition Author(s): Andreeva, A. , Bobay, B.G. , Cavanagh, J. , Mueller, G.A. , Murzin, A.G.