Structure of rabenosyn (458-503), rab4 binding domain
PDB DOI: 10.2210/pdb1yzm/pdb
Classification: PROTEIN TRANSPORT Organism(s): Homo Sapiens
Deposited: 2005-02-28 Deposition Author(s): Eathiraj, S. , Lambright, D.G. , Pan, X. , Ritacco, C.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Structure of rabenosyn (458-503), rab4 binding domain
Eathiraj, S. , Lambright, D.G. , Pan, X. , Ritacco, C.
Primary Citation of Related Structures: 1YZM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FYVE-finger-containing Rab5 effector protein rabenosyn-5 | A | 51 | Homo Sapiens | GPLGSPLLQQIHNITSFIRQAKAAGRMDEVRTLQENLRQLQDEYDQQQTEK |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-02-28 Deposition Author(s): Eathiraj, S. , Lambright, D.G. , Pan, X. , Ritacco, C.