1YY6
The crystal structure of the n-terminal domain of hausp/usp7 complexed with an ebna1 peptide
PDB DOI: 10.2210/pdb1yy6/pdb
Classification: HYDROLASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-02-23 Deposition Author(s): Arrowsmith, C.H. , Edwards, A.M. , Frappier, L. , Holowaty, M. , Lee, W. , Liao, J. , Nguyen, T. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Shire, K. , Zhang, R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
The crystal structure of the n-terminal domain of hausp/usp7 complexed with an ebna1 peptide
Arrowsmith, C.H. , Edwards, A.M. , Frappier, L. , Holowaty, M. , Lee, W. , Liao, J. , Nguyen, T. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Shire, K. , Zhang, R.
Primary Citation of Related Structures: 1YY6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin carboxyl-terminal hydrolase 7 | A | 155 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW |
| Epstein-Barr nuclear antigen-1 | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DPGEGPSTGP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2005-02-23 Deposition Author(s): Arrowsmith, C.H. , Edwards, A.M. , Frappier, L. , Holowaty, M. , Lee, W. , Liao, J. , Nguyen, T. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Shire, K. , Zhang, R.