Structure of the fbp11ww1 domain
PDB DOI: 10.2210/pdb1ywj/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-02-18 Deposition Author(s): Aido-Machado, R. , Boehm, G. , Oschkinat, H. , Otte, L. , Parthier, C. , Pires, J.R. , Rudolph, R. , Wiedemann, U.
Structure of the fbp11ww1 domain
Aido-Machado, R. , Boehm, G. , Oschkinat, H. , Otte, L. , Parthier, C. , Pires, J.R. , Rudolph, R. , Wiedemann, U.
Primary Citation of Related Structures: 1YWJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Formin-binding protein 3 | A | 41 | Homo Sapiens | GSRRASVGSAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDD |
Method: SOLUTION NMR
Deposited Date: 2005-02-18 Deposition Author(s): Aido-Machado, R. , Boehm, G. , Oschkinat, H. , Otte, L. , Parthier, C. , Pires, J.R. , Rudolph, R. , Wiedemann, U.