Solution structure of the anti-apoptotic protein bcl-xl in complex with ""sar by nmr"" ligands
PDB DOI: 10.2210/pdb1ysg/pdb
Classification: APOPTOSIS Organism(s): Salmonella Enterica
Deposited: 2005-02-08 Deposition Author(s): Armstrong, R.C. , Augeri, D.J. , Belli, B.A. , Bruncko, M. , Deckwerth, T.L. , Dinges, J. , Elmore, S.W. , Fesik, S.W. , Hajduk, P.J. , Joseph, M.K. , Kitada, S. , Korsmeyer, S.J. , Kunzer, A.R. , Letai, A. , Li, C. , Mitten, M.J. , Nettesheim, D.G. , Ng, S. , Nimmer, P.M. , O'Connor, J.M. , Oleksijew, A. , Oltersdorf, T. , Petros, A.M. , Reed, J.C. , Rosenberg, S.H. , Shen, W. , Shoemaker, A.R. , Tahir, S.K. , Thompson, C.B. , Tomaselli, K.J. , Wang, B. , Wendt, M.D. , Zhang, H.
Solution structure of the anti-apoptotic protein bcl-xl in complex with ""sar by nmr"" ligands
Armstrong, R.C. , Augeri, D.J. , Belli, B.A. , Bruncko, M. , Deckwerth, T.L. , Dinges, J. , Elmore, S.W. , Fesik, S.W. , Hajduk, P.J. , Joseph, M.K. , Kitada, S. , Korsmeyer, S.J. , Kunzer, A.R. , Letai, A. , Li, C. , Mitten, M.J. , Nettesheim, D.G. , Ng, S. , Nimmer, P.M. , O'Connor, J.M. , Oleksijew, A. , Oltersdorf, T. , Petros, A.M. , Reed, J.C. , Rosenberg, S.H. , Shen, W. , Shoemaker, A.R. , Tahir, S.K. , Thompson, C.B. , Tomaselli, K.J. , Wang, B. , Wendt, M.D. , Zhang, H.
Primary Citation of Related Structures: 1YSG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Apoptosis regulator Bcl-X | A | 181 | Salmonella Enterica | MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2005-02-08 Deposition Author(s): Armstrong, R.C. , Augeri, D.J. , Belli, B.A. , Bruncko, M. , Deckwerth, T.L. , Dinges, J. , Elmore, S.W. , Fesik, S.W. , Hajduk, P.J. , Joseph, M.K. , Kitada, S. , Korsmeyer, S.J. , Kunzer, A.R. , Letai, A. , Li, C. , Mitten, M.J. , Nettesheim, D.G. , Ng, S. , Nimmer, P.M. , O'Connor, J.M. , Oleksijew, A. , Oltersdorf, T. , Petros, A.M. , Reed, J.C. , Rosenberg, S.H. , Shen, W. , Shoemaker, A.R. , Tahir, S.K. , Thompson, C.B. , Tomaselli, K.J. , Wang, B. , Wendt, M.D. , Zhang, H.