Structure of a novel photoreceptor: the bluf domain of appa from rhodobacter sphaeroides
PDB DOI: 10.2210/pdb1yrx/pdb
Classification: TRANSCRIPTION Organism(s): Rhodobacter Sphaeroides 2.4.1
Deposited: 2005-02-05 Deposition Author(s): Anderson, S. , Bauer, C. , Dragnea, V. , Masuda, S. , Moffat, K. , Ybe, J.
Structure of a novel photoreceptor: the bluf domain of appa from rhodobacter sphaeroides
Anderson, S. , Bauer, C. , Dragnea, V. , Masuda, S. , Moffat, K. , Ybe, J.
Primary Citation of Related Structures: 1YRX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| hypothetical protein Rsph03001874 | A | 121 | Rhodobacter Sphaeroides 2.4.1 | AGHMVSCCYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLAESRQIVTVGRSL |
| hypothetical protein Rsph03001874 | B | 121 | Rhodobacter Sphaeroides 2.4.1 | AGHMVSCCYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLAESRQIVTVGRSL |
| hypothetical protein Rsph03001874 | C | 121 | Rhodobacter Sphaeroides 2.4.1 | AGHMVSCCYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLAESRQIVTVGRSL |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-02-05 Deposition Author(s): Anderson, S. , Bauer, C. , Dragnea, V. , Masuda, S. , Moffat, K. , Ybe, J.