Crystal structure of a probable flavoprotein from thermus thermophilus hb8
PDB DOI: 10.2210/pdb1yoa/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Thermus Thermophilus
Deposited: 2005-01-27 Deposition Author(s): Imagawa, T. , Kuramitsu, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugimoto, Y. , Tsuge, H. , Utsunomiya, H. , Yokoyama, S.
Crystal structure of a probable flavoprotein from thermus thermophilus hb8
Imagawa, T. , Kuramitsu, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugimoto, Y. , Tsuge, H. , Utsunomiya, H. , Yokoyama, S.
Primary Citation of Related Structures: 1YOA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| putative flavoprotein | A | 159 | Thermus Thermophilus | MNLEAKKKVLRSFTYGLYVLTAKDGDEVAAGTVNWVTQASFQPPLVAVGLKRDSHLHALVERTGKLALMTLAHDQKAIAQDFFKPTVREGDRLNGHPFEPSPTFGLPLLTELPYWLEAEVRHLYPGGDHSLVVAEVVEAGVRREEKPLVMWDTGWFYGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-01-27 Deposition Author(s): Imagawa, T. , Kuramitsu, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugimoto, Y. , Tsuge, H. , Utsunomiya, H. , Yokoyama, S.