Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from ralstonia metallidurans complexed with 4-chloro-3-hydroxyanthranilic acid and o2
PDB DOI: 10.2210/pdb1yfw/pdb
Classification: OXIDOREDUCTASE Organism(s): Cupriavidus Metallidurans
Deposited: 2005-01-04 Deposition Author(s): Begley, T.P. , Colabroy, K.L. , Ealick, S.E. , Zhang, Y.
Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from ralstonia metallidurans complexed with 4-chloro-3-hydroxyanthranilic acid and o2
Begley, T.P. , Colabroy, K.L. , Ealick, S.E. , Zhang, Y.
Primary Citation of Related Structures: 1YFW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 3-hydroxyanthranilate-3,4-dioxygenase | A | 174 | Cupriavidus Metallidurans | MLTYGAPFNFPRWIDEHAHLLKPPVGNRQVWQDSDFIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLNLWVDGRRERADLKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPAGMLDGFEWYCDACGHLVHRVEVQLKSIVTDLPPLFESFYASEDKRRCPHCGQVHPGRAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-01-04 Deposition Author(s): Begley, T.P. , Colabroy, K.L. , Ealick, S.E. , Zhang, Y.