Nmr structure family of human agouti signalling protein (80-132: q115y, s124y)
PDB DOI: 10.2210/pdb1y7k/pdb
Classification: SIGNALING PROTEIN Organism(s): N.A.
Deposited: 2004-12-08 Deposition Author(s): Barsh, G.S. , Chai, B. , Dawson, P.E. , Gantz, I. , Jackson, P.J. , Mcnulty, J.C. , Millhauser, G.L. , Thompson, D.A.
Nmr structure family of human agouti signalling protein (80-132: q115y, s124y)
Barsh, G.S. , Chai, B. , Dawson, P.E. , Gantz, I. , Jackson, P.J. , Mcnulty, J.C. , Millhauser, G.L. , Thompson, D.A.
Primary Citation of Related Structures: 1Y7K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Agouti Signaling Protein | A | 53 | N.A. | KKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCYCRFFRSACYCRVLSLNC |
Method: SOLUTION NMR
Deposited Date: 2004-12-08 Deposition Author(s): Barsh, G.S. , Chai, B. , Dawson, P.E. , Gantz, I. , Jackson, P.J. , Mcnulty, J.C. , Millhauser, G.L. , Thompson, D.A.