Co-evolution of protein and rna structures within a highly conserved ribosomal domain
PDB DOI: 10.2210/pdb1y39/pdb
Classification: STRUCTURAL PROTEIN/RNA Organism(s): Geobacillus Stearothermophilus , Synthetic Construct
Deposited: 2004-11-24 Deposition Author(s): Conn, G.L. , Draper, D.E. , Dunstan, M.S. , Guhathakurta, D.
Method: X-RAY DIFFRACTION Resolution: 2.8 Å
Co-evolution of protein and rna structures within a highly conserved ribosomal domain
Conn, G.L. , Draper, D.E. , Dunstan, M.S. , Guhathakurta, D.
Primary Citation of Related Structures: 1Y39
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
50S ribosomal protein L11 | A | 76 | Geobacillus Stearothermophilus , Synthetic Construct | FTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARNMGIVVED |
50S ribosomal protein L11 | B | 76 | Geobacillus Stearothermophilus , Synthetic Construct | FTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARNMGIVVED |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-11-24 Deposition Author(s): Conn, G.L. , Draper, D.E. , Dunstan, M.S. , Guhathakurta, D.