Structural characterization of nop10p using nuclear magnetic resonance spectroscopy
PDB DOI: 10.2210/pdb1y2y/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Saccharomyces Cerevisiae
Deposited: 2004-11-23 Deposition Author(s): Caizergues-Ferrer, M. , Feigon, J. , Johansson, C. , Khanna, M. , Wu, H.
Structural characterization of nop10p using nuclear magnetic resonance spectroscopy
Caizergues-Ferrer, M. , Feigon, J. , Johansson, C. , Khanna, M. , Wu, H.
Primary Citation of Related Structures: 1Y2Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribosome biogenesis protein Nop10 | A | 58 | Saccharomyces Cerevisiae | MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ |
Method: SOLUTION NMR
Deposited Date: 2004-11-23 Deposition Author(s): Caizergues-Ferrer, M. , Feigon, J. , Johansson, C. , Khanna, M. , Wu, H.