Crystal structure of of the sh3 domain of phospholipase c gamma-1
PDB DOI: 10.2210/pdb1y0m/pdb
Classification: HYDROLASE Organism(s): Rattus Norvegicus
Deposited: 2004-11-15 Deposition Author(s): Mariuzza, R. , Sangwoo, C.
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Crystal structure of of the sh3 domain of phospholipase c gamma-1
Primary Citation of Related Structures: 1Y0M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1 | A | 61 | Rattus Norvegicus | TFKSAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMIN |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-11-15 Deposition Author(s): Mariuzza, R. , Sangwoo, C.