1XSW
The solid-state nmr structure of kaliotoxin
PDB DOI: 10.2210/pdb1xsw/pdb
Classification: TOXIN Organism(s): Androctonus Mauretanicus Mauretanicus
Deposited: 2004-10-20 Deposition Author(s): Baldus, M. , Becker, S. , Giller, K. , Lange, A. , Pongs, O. , Seidel, K.
Experimental Data Snapshot
Method: SOLID-STATE NMR Resolution: N.A.
The solid-state nmr structure of kaliotoxin
Baldus, M. , Becker, S. , Giller, K. , Lange, A. , Pongs, O. , Seidel, K.
Primary Citation of Related Structures: 1XSW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kaliotoxin 1 | A | 38 | Androctonus Mauretanicus Mauretanicus | GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK |
Experimental Data
Method: SOLID-STATE NMR
Deposited Date: 2004-10-20 Deposition Author(s): Baldus, M. , Becker, S. , Giller, K. , Lange, A. , Pongs, O. , Seidel, K.