Solution structure of a resuscitation promoting factor domain from mycobacterium tuberculosis
PDB DOI: 10.2210/pdb1xsf/pdb
Classification: CELL CYCLE, HYDROLASE Organism(s): Mycobacterium Tuberculosis
Deposited: 2004-10-19 Deposition Author(s): Barthe, P. , Cohen-Gonsaud, M. , Henderson, B. , Keep, N.H. , Roumestand, C. , Ward, J.
Solution structure of a resuscitation promoting factor domain from mycobacterium tuberculosis
Barthe, P. , Cohen-Gonsaud, M. , Henderson, B. , Keep, N.H. , Roumestand, C. , Ward, J.
Primary Citation of Related Structures: 1XSF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable resuscitation-promoting factor rpfB | A | 108 | Mycobacterium Tuberculosis | NVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAINTGNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVTRLRQGWGAWPVCAARAGAR |
Method: SOLUTION NMR
Deposited Date: 2004-10-19 Deposition Author(s): Barthe, P. , Cohen-Gonsaud, M. , Henderson, B. , Keep, N.H. , Roumestand, C. , Ward, J.