Crystal structure of f1-mutant s105a complex with pck
PDB DOI: 10.2210/pdb1xqx/pdb
Classification: HYDROLASE Organism(s): Thermoplasma Acidophilum
Deposited: 2004-10-13 Deposition Author(s): Brandstetter, H. , Goehring, W. , Goettig, P. , Groll, M. , Huber, R. , Kim, J.-S. , Konarev, P.V. , Svergun, D.I.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of f1-mutant s105a complex with pck
Brandstetter, H. , Goehring, W. , Goettig, P. , Groll, M. , Huber, R. , Kim, J.-S. , Konarev, P.V. , Svergun, D.I.
Primary Citation of Related Structures: 1XQX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proline iminopeptidase | A | 293 | Thermoplasma Acidophilum | MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSAYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-10-13 Deposition Author(s): Brandstetter, H. , Goehring, W. , Goettig, P. , Groll, M. , Huber, R. , Kim, J.-S. , Konarev, P.V. , Svergun, D.I.