1XI7
Nmr structure of the carboxyl-terminal cysteine domain of the vhv1.1 polydnaviral gene product
PDB DOI: 10.2210/pdb1xi7/pdb
Classification: VIRAL PROTEIN Organism(s): Campoletis Sonorensis Ichnovirus
Deposited: 2004-09-21 Deposition Author(s): Copie, V. , Einerwold, J. , Hapner, K. , Jaseja, M. , Webb, B.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the carboxyl-terminal cysteine domain of the vhv1.1 polydnaviral gene product
Copie, V. , Einerwold, J. , Hapner, K. , Jaseja, M. , Webb, B.
Primary Citation of Related Structures: 1XI7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cysteine-rich omega-conotoxin homolog VHv1.1 | A | 61 | Campoletis Sonorensis Ichnovirus | AMVSSTCIGHYQKCVNADKPCCSKTVRYGDSKNVRKFICDRDGEGVCVPFDGGVRGLPNGA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2004-09-21 Deposition Author(s): Copie, V. , Einerwold, J. , Hapner, K. , Jaseja, M. , Webb, B.