Structure of the par-6 pdz domain with a pals1 internal ligand
PDB DOI: 10.2210/pdb1x8s/pdb
Classification: CELL CYCLE Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2004-08-18 Deposition Author(s): Divittorio, H.M. , Penkert, R.R. , Prehoda, K.E.
Structure of the par-6 pdz domain with a pals1 internal ligand
Divittorio, H.M. , Penkert, R.R. , Prehoda, K.E.
Primary Citation of Related Structures: 1X8S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CG5884-PA | A | 102 | Drosophila Melanogaster , Synthetic Construct | GSETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQR |
| Pals1 peptide | B | 12 | Drosophila Melanogaster , Synthetic Construct | YPKHREMAVDCP |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-08-18 Deposition Author(s): Divittorio, H.M. , Penkert, R.R. , Prehoda, K.E.