Solution structure of the peptidoglycan binding domain of b. subtilis cell wall lytic enzyme cwlc
PDB DOI: 10.2210/pdb1x60/pdb
Classification: HYDROLASE Organism(s): Tomato Spotted Wilt Virus (Strain Bulgarian L3)
Deposited: 2005-05-17 Deposition Author(s): Kato, K. , Kojima, C. , Mishima, M. , Sekiguchi, J. , Shida, T. , Yabuki, K.
Solution structure of the peptidoglycan binding domain of b. subtilis cell wall lytic enzyme cwlc
Kato, K. , Kojima, C. , Mishima, M. , Sekiguchi, J. , Shida, T. , Yabuki, K.
Primary Citation of Related Structures: 1X60
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Sporulation-specific N-acetylmuramoyl-L-alanine amidase | A | 79 | Tomato Spotted Wilt Virus (Strain Bulgarian L3) | LKKTSSSGLYKVQIGAFKVKANADSLASNAEAKGFDSIVLLKDGLYKVQIGAFSSKDNADTLAARAKNAGFDAIVILES |
Method: SOLUTION NMR
Deposited Date: 2005-05-17 Deposition Author(s): Kato, K. , Kojima, C. , Mishima, M. , Sekiguchi, J. , Shida, T. , Yabuki, K.