Solution structure of the fibronectin type-iii domain of mouse myosin-binding protein c, fast-type homolog
PDB DOI: 10.2210/pdb1x5y/pdb
Classification: CELL ADHESION Organism(s): Mus Musculus
Deposited: 2005-05-17 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Solution structure of the fibronectin type-iii domain of mouse myosin-binding protein c, fast-type homolog
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 1X5Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| myosin binding protein C, fast-type | A | 111 | Mus Musculus | GSSGSSGPTSAPQHLTVEDVTDTTTTLKWRPPDRIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIRESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-17 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Yokoyama, S. , Yoneyama, M.