Solution structure of surp domain in sfrs14 protei
PDB DOI: 10.2210/pdb1x4p/pdb
Classification: RNA BINDING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2005-05-14 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of surp domain in sfrs14 protei
He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1X4P
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative splicing factor, arginine/serine-rich 14 | A | 66 | Salmonella Enterica | GSSGSSGVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-14 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.