Solution structure of phd domain in inhibitor of growth protein 3 (ing3)
PDB DOI: 10.2210/pdb1x4i/pdb
Classification: CELL ADHESION Organism(s): Homo Sapiens
Deposited: 2005-05-14 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of phd domain in inhibitor of growth protein 3 (ing3)
He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1X4I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Inhibitor of growth protein 3 | A | 70 | Homo Sapiens | GSSGSSGYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHKSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-14 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.