Solution structure of the second dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
PDB DOI: 10.2210/pdb1x48/pdb
Classification: RNA BINDING PROTEIN Organism(s): Enterobacter Aerogenes
Deposited: 2005-05-14 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.
Solution structure of the second dsrm domain in interferon-induced, double-stranded rna-activated protein kinase
He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1X48
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Interferon-induced, double-stranded RNA-activated protein kinase | A | 88 | Enterobacter Aerogenes | GSSGSSGYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-14 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tarada, T. , Yokoyama, S.