1X41
Solution structure of the myb-like dna binding domain of human transcriptional adaptor 2-like, isoform b
PDB DOI: 10.2210/pdb1x41/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2005-05-12 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Sato, M. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the myb-like dna binding domain of human transcriptional adaptor 2-like, isoform b
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Sato, M. , Yokoyama, S.
Primary Citation of Related Structures: 1X41
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional adaptor 2-like, isoform b | A | 60 | Homo Sapiens | GSSGSSGDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYFSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-05-12 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sasagawa, A. , Sato, M. , Yokoyama, S.