Three dimensional solution structure of the chromo1 domain of cpsrp43
PDB DOI: 10.2210/pdb1x32/pdb
Classification: SIGNALING PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2005-04-28 Deposition Author(s): Henry, R. , Kumar, T.K. , Sivaraja, V. , Yu, C.
Three dimensional solution structure of the chromo1 domain of cpsrp43
Henry, R. , Kumar, T.K. , Sivaraja, V. , Yu, C.
Primary Citation of Related Structures: 1X32
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| chloroplast signal recognition particle component | A | 47 | Arabidopsis Thaliana | GSGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEY |
Method: SOLUTION NMR
Deposited Date: 2005-04-28 Deposition Author(s): Henry, R. , Kumar, T.K. , Sivaraja, V. , Yu, C.