Nmr structure determined for mlv nc complex with rna sequence aacagu
PDB DOI: 10.2210/pdb1wwd/pdb
Classification: Viral protein/RNA Organism(s): Moloney Murine Leukemia Virus , Synthetic Construct
Deposited: 2005-01-05 Deposition Author(s): Dey, A. , Smalls-Mantey, A. , Summers, M.F. , York, D.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure determined for mlv nc complex with rna sequence aacagu
Dey, A. , Smalls-Mantey, A. , Summers, M.F. , York, D.
Primary Citation of Related Structures: 1WWD
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-R(P*AP*AP*CP*AP*GP*U)-3' | b | 6 | NA | AACAGU |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nucleoprotein p10 | A | 56 | Moloney Murine Leukemia Virus , Synthetic Construct | ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLL |
Method: SOLUTION NMR
Deposited Date: 2005-01-05 Deposition Author(s): Dey, A. , Smalls-Mantey, A. , Summers, M.F. , York, D.