Crystal structure of hypothetical protein ttha1013 from an extremely thermophilic bacterium thermus thermophilus hb8
PDB DOI: 10.2210/pdb1wv8/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Thermus Thermophilus
Deposited: 2004-12-12 Deposition Author(s): Hattori, M. , Kuramitsu, S. , Mizohata, E. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Yokoyama, S.
Crystal structure of hypothetical protein ttha1013 from an extremely thermophilic bacterium thermus thermophilus hb8
Hattori, M. , Kuramitsu, S. , Mizohata, E. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Yokoyama, S.
Primary Citation of Related Structures: 1WV8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| hypothetical protein TTHA1013 | A | 73 | Thermus Thermophilus | MRTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVMVPELLEENGVALELPVELRLEATRPLVFS |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-12-12 Deposition Author(s): Hattori, M. , Kuramitsu, S. , Mizohata, E. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Yokoyama, S.