Crystal structure of beta hordothionin
PDB DOI: 10.2210/pdb1wuw/pdb
Classification: PLANT PROTEIN Organism(s): Actinomadura Kijaniata
Deposited: 2004-12-09 Deposition Author(s): Johnson, K.A. , Kim, E. , Stec, B. , Suh, S.W. , Teeter, M.M.
Crystal structure of beta hordothionin
Johnson, K.A. , Kim, E. , Stec, B. , Suh, S.W. , Teeter, M.M.
Primary Citation of Related Structures: 1WUW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Beta-hordothionin | A | 45 | Actinomadura Kijaniata | KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK |
Beta-hordothionin | B | 45 | Actinomadura Kijaniata | KSCCRSTLGRNCYNLCRVRGAQKLCANACRCKLTSGLKCPSSFPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-12-09 Deposition Author(s): Johnson, K.A. , Kim, E. , Stec, B. , Suh, S.W. , Teeter, M.M.