Crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8
PDB DOI: 10.2210/pdb1wub/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Thermus Thermophilus
Deposited: 2004-12-03 Deposition Author(s): Doi-Katayama, Y. , Hamana, H. , Handa, N. , Hirota, H. , Idaka, M. , Ishizuka, Y. , Kuramitsu, S. , Park, S.-Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tame, J.R.H. , Terada, T. , Yokoyama, S.
Crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8
Doi-Katayama, Y. , Hamana, H. , Handa, N. , Hirota, H. , Idaka, M. , Ishizuka, Y. , Kuramitsu, S. , Park, S.-Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tame, J.R.H. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WUB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| conserved hypothetical protein TT1927b | A | 178 | Thermus Thermophilus | MKWNLDPSHTSIDFKVRHMGIASVRGSLKVLSGSVETDEAGRPIQVEAVIDAASIATGEPQRDGHLRSADFLHAEQYPEIRFVSTQIEPLGGNRYRIQGNLTIRDITKPVTLEAEVSAPIKDPWGMQRVAASASGQINRKDWNLTWNQVLELGALLVGEEVKFNLEVEAVAPAPVAAQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-12-03 Deposition Author(s): Doi-Katayama, Y. , Hamana, H. , Handa, N. , Hirota, H. , Idaka, M. , Ishizuka, Y. , Kuramitsu, S. , Park, S.-Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Tame, J.R.H. , Terada, T. , Yokoyama, S.