Hyperthermophile chromosomal protein sac7d single mutant m29a in complex with dna gtaattac
PDB DOI: 10.2210/pdb1wtv/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Sulfolobus Acidocaldarius , Synthetic Construct
Deposited: 2004-11-29 Deposition Author(s): Chen, C.-J. , Chen, C.-Y. , Chou, C.-C. , Ko, T.-P. , Lin, T.-W. , Wang, A.H.-J.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Hyperthermophile chromosomal protein sac7d single mutant m29a in complex with dna gtaattac
Chen, C.-J. , Chen, C.-Y. , Chou, C.-C. , Ko, T.-P. , Lin, T.-W. , Wang, A.H.-J.
Primary Citation of Related Structures: 1WTV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA-binding proteins 7a/7b/7d | A | 66 | Sulfolobus Acidocaldarius , Synthetic Construct | MVKVKFKYKGEEKEVDTSKIKKVWRVGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-11-29 Deposition Author(s): Chen, C.-J. , Chen, C.-Y. , Chou, C.-C. , Ko, T.-P. , Lin, T.-W. , Wang, A.H.-J.