Complex structure of the c-terminal rna-binding domain of hnrnp d (auf1) with telomere dna
PDB DOI: 10.2210/pdb1wtb/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2004-11-22 Deposition Author(s): Enokizono, Y. , Ishikawa, F. , Katahira, M. , Konishi, Y. , Nagata, K. , Ouhashi, K. , Uesugi, S.
Method: SOLUTION NMR Resolution: N.A.
Complex structure of the c-terminal rna-binding domain of hnrnp d (auf1) with telomere dna
Enokizono, Y. , Ishikawa, F. , Katahira, M. , Konishi, Y. , Nagata, K. , Ouhashi, K. , Uesugi, S.
Primary Citation of Related Structures: 1WTB
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-D(P*TP*AP*GP*G)-3' | b | 4 | NA | TAGG |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Heterogeneous nuclear ribonucleoprotein D0 | A | 79 | Homo Sapiens , Synthetic Construct | VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMS |
Method: SOLUTION NMR
Deposited Date: 2004-11-22 Deposition Author(s): Enokizono, Y. , Ishikawa, F. , Katahira, M. , Konishi, Y. , Nagata, K. , Ouhashi, K. , Uesugi, S.