Evidence for domain-specific recognition of sk and kv channels by mtx and hstx1 scorpion toxins
PDB DOI: 10.2210/pdb1wpd/pdb
Classification: TOXIN Organism(s): Heterometrus Spinifer , Scorpio Palmatus
Deposited: 2004-09-01 Deposition Author(s): Andreotti, N. , Beeton, C. , Chandy, G.K. , Darbon, H. , De Waard, M. , Ferrat, G. , Regaya, I. , Sabatier, J.M.
Method: SOLUTION NMR Resolution: N.A.
Evidence for domain-specific recognition of sk and kv channels by mtx and hstx1 scorpion toxins
Andreotti, N. , Beeton, C. , Chandy, G.K. , Darbon, H. , De Waard, M. , Ferrat, G. , Regaya, I. , Sabatier, J.M.
Primary Citation of Related Structures: 1WPD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin alpha-KTx 6.2,Potassium channel toxin alpha-KTx 6.3 | A | 34 | Heterometrus Spinifer , Scorpio Palmatus | VSCTGSKDCYAPCRKQTGCPYGKCMNRKCKCNRC |
Method: SOLUTION NMR
Deposited Date: 2004-09-01 Deposition Author(s): Andreotti, N. , Beeton, C. , Chandy, G.K. , Darbon, H. , De Waard, M. , Ferrat, G. , Regaya, I. , Sabatier, J.M.