Crystal structure of methylglyoxal synthase from thermus thermophilus hb8
PDB DOI: 10.2210/pdb1wo8/pdb
Classification: LYASE Organism(s): Thermus Thermophilus Hb8
Deposited: 2004-08-12 Deposition Author(s): Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of methylglyoxal synthase from thermus thermophilus hb8
Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.
Primary Citation of Related Structures: 1WO8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| methylglyoxal synthase | A | 126 | Thermus Thermophilus Hb8 | MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQDPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ |
| methylglyoxal synthase | B | 126 | Thermus Thermophilus Hb8 | MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQDPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ |
| methylglyoxal synthase | C | 126 | Thermus Thermophilus Hb8 | MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQDPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ |
| methylglyoxal synthase | D | 126 | Thermus Thermophilus Hb8 | MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQDPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ |
| methylglyoxal synthase | E | 126 | Thermus Thermophilus Hb8 | MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQDPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ |
| methylglyoxal synthase | F | 126 | Thermus Thermophilus Hb8 | MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQDPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-08-12 Deposition Author(s): Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sugahara, M.